Print…

You Searched For: TOSOH+Bioscience


21 154  results were found

Refine Results Sort by
SearchResultCount:"21154"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-COBSAP-1718

Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (AP (Alkaline Phosphatase)) [clone: M2]

Catalog Number: (COBSAP-1718)
Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (AP (Alkaline Phosphatase)) [clone: M2]
UOM: 1 * 100 µG
Image Unavailable-COBSD11-1711

Anti-6X His tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: AD1.1.10]

Catalog Number: (COBSD11-1711)
Supplier: Columbia Biosciences
Description: Anti-6X His tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: AD1.1.10]
UOM: 1 * 100 µG
Image Unavailable-COBSD9-1722

Anti-HA tag Mouse Monoclonal Antibody (DyLight® 550) [clone: 16B12]

Catalog Number: (COBSD9-1722)
Supplier: Columbia Biosciences
Description: Anti-HA tag Mouse Monoclonal Antibody (DyLight® 550) [clone: 16B12]
UOM: 1 * 100 µG

Certificates


Image Unavailable-COBSD5-1714

Anti-c-Myc tag Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 9E10]

Catalog Number: (COBSD5-1714)
Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 9E10]
UOM: 1 * 100 µG
Image Unavailable-COBSD17-1714-1MG

Anti-c-Myc tag Mouse Monoclonal Antibody (Europium 1024) [clone: 9E10]

Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody (Europium 1024) [clone: 9E10]

Image Unavailable-DG097

3-[(3-Cholamidopropyl)dimethylammonio]-1-propane sulphate (CHAPS) 5% in aqueous solution

Catalog Number: (DG097)
Supplier: G-Biosciences
Description: 3-[(3-Cholamidopropyl)dimethylammonio]-1-propane sulphate (CHAPS) 5% in aqueous solution
UOM: 1 * 50 mL
Image Unavailable-COBSD3-1866-50

Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))

Catalog Number: (COBSD3-1866-50)
Supplier: Columbia Biosciences
Description: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 50 µG
Image Unavailable-BC11

MBS (N-Succinimidyl 3-maleimidobenzoate)

Catalog Number: (BC11)
Supplier: G-Biosciences
Description: Ideal for hapten-carrier protein, toxin-antibody, enzyme-antibody crosslinking
UOM: 1 * 100 mg
Image Unavailable-786-279

Guanidinium hydrochloride 8 mol/l in aqueous solution

Catalog Number: (786-279)
Supplier: G-Biosciences
Description: A selection of strong chemicals to aid in the denaturation of proteins. Denaturants, or chaotropes, disrupt water interactions resulting in the solubilization of hydrophobic proteins and peptides. The chaotropes also act on all proteins to unfold them and alter their three-dimensional structure.
UOM: 1 * 200 mL

Certificates


Product Image-API-02

(S)-(+)-Camptothecin 2 mM

Catalog Number: (API-02)
Supplier: G-Biosciences
Description: Apoptosis is commonly defined as programmed mechanism of cell death and is a highly regulated process that can be initiated by a variety of internal and external stimuli (inducers).
UOM: 1 * 1 mL
Product Image-OZBILK10000

D-(-)-Luciferin potassium salt ≥99.5% endotoxin-free

Catalog Number: (OZBILK10000)
Supplier: OZ BIOSCIENCES
Description: OZ Biosciences D-Luciferin K+ and Na+ salts are routinely used as Firefly’s Luciferase substrate in in vitro and in vivo bioluminescent assays. The quality and purity of the D-Luciferin are essential to obtain good and reproducible results. OZ Biosciences is offering high quality of Endotoxin-Free D-Luciferin K+ and Na+ salts.
Store at -20°C and protect from light
UOM: 1 * 1 g
Image Unavailable-BC85

Guanidinium hydrochloride

Supplier: G-Biosciences
Description: A selection of strong chemicals to aid in the denaturation of proteins. Denaturants, or chaotropes, disrupt water interactions resulting in the solubilization of hydrophobic proteins and peptides. The chaotropes also act on all proteins to unfold them and alter their three-dimensional structure.

Product Image-786-247

Protein fractionation kit, FOCUS™ soluble and insoluble

Catalog Number: (786-247)
Supplier: G-Biosciences
Description: FOCUS™ Soluble & Insoluble is a complete kit for the selective preparation of soluble (hydrophilic) and insoluble (hydrophobic) proteins from mammalian tissues and cells, plants, yeast, bacteria, and other biological samples. The kit comes with reagents necessary for fractionation of soluble and insoluble fractions, including a strong chaotropic extraction buffer to solubilise difficult proteins.
UOM: 1 * 1 KIT
Image Unavailable-35-4031-U100

Rat IgG2b Isotype Control [clone: LTF-2] (FITC (Fluorescein Isothiocyanate))

Catalog Number: (35-4031-U100)
Supplier: Tonbo Biosciences
Description: The LTF-2 immunoglobulin is useful as an isotype-matched control. The LTF-2 immunolglobulin has an unknown binding specificity and is used as an isotype control for rat IgG2b antibodies.
UOM: 1 * 100 µG
Image Unavailable-35-4321-U100

Rat IgG2a Isotype Control [clone: 2A3] (FITC (Fluorescein Isothiocyanate))

Catalog Number: (35-4321-U100)
Supplier: Tonbo Biosciences
Description: The 2A3 immunoglobulin is useful as an isotype-matched control. The 2A3 immunolglobulin has an unknown binding specificity and is used as an isotype control for rat IgG2a antibodies.
UOM: 1 * 100 µG
Product Image-60-4321-U100

Rat IgG2a Isotype Control [clone: 2A3] (PE (Phycoerythrin)-Cy7®)

Catalog Number: (60-4321-U100)
Supplier: Tonbo Biosciences
Description: The 2A3 immunoglobulin is useful as an isotype-matched control. The 2A3 immunolglobulin has an unknown binding specificity and is used as an isotype control for rat IgG2a antibodies.
UOM: 1 * 100 µG
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at +43 1 97002 - 0.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at +43 1 97002 - 0.
Dual use goods can only be delivered within the European Union.
Dual use goods can only be delivered within the European Union.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at +43 1 97002 - 0.
529 - 544 of 21 154
no targeter for Bottom